.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lm7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of DUF1341 representative, from Yersinia enterocolitica subsp. enterocolitica 8081. To be Published
    Site MCSG
    PDB Id 3lm7 Target Id APC38723
    Molecular Characteristics
    Source Yersinia enterocolitica subsp. enterocolitica 8081
    Alias Ids TPS33250,CAL13803.1, PF07071.1.HMM.1, 393305 Molecular Weight 26377.75 Da.
    Residues 246 Isoelectric Point 5.79
    Sequence mkltpnyyrdrvclnvlagskdnaraiyqaaeghvlvgvlsknypdvdsavkdmreyaalidnalsvgl gagdprqsvmvsqisqqvqpqhvnqvftgvgasrallgqhdtvvnglisptgkvgyvkistgplssqqk daivpvttaiamlkdmggssvkffpmngldsideyrfvaeacaatgfwleptggidldnfeqivqiald agvtkviphiyssiidsktgntrpedvktlldivkkivq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.19173
    Matthews' coefficent 2.23 Rfactor 0.13498
    Waters 720 Solvent Content 44.79

    Ligand Information
    Ligands
    Metals BR (BROMIDE) x 2;K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 3lm7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch