.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ll7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative methyltransferase PG_1098 from Porphyromonas gingivalis W83. To be Published
    Site MCSG
    PDB Id 3ll7 Target Id APC90227
    Molecular Characteristics
    Source Porphyromonas gingivalis w83
    Alias Ids TPS33287,AAQ66209.1, 3.40.50.150, 242619 Molecular Weight 45643.30 Da.
    Residues 407 Isoelectric Point 6.53
    Sequence mlfdekeilaitrwaklyanqspdrillgsndippeyraavatqielwprlrnklpqwagisslyipsr lsleqssgavtssyksrfiregtkvvdltgglgidfialmskasqgiyierndetavaarhniplllne gkdvniltgdfkeylpliktfhpdyiyvdparrsgadkrvyaiadcepdliplatellpfcssilakls pmidlwdtlqsllhvqelhvvaahgevkellvrmslneatippekvpihainllledtvipfiftmeee rsisipytdsidkyvyephtallkagafktvayrlglrklhpnshlytseayesafpgrtfvleeiipf stsvlkqlrkvvpqasiscrnfplspielrqrskmadggektlmgttmadgkkvllllrkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.20863
    Matthews' coefficent 2.79 Rfactor 0.18150
    Waters 357 Solvent Content 55.89

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 4;FMT (FORMIC) x 5
    Metals

    Jmol

     
    Google Scholar output for 3ll7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch