.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ljl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the full-length transcriptional regulator LuxT from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3ljl Target Id APC91483.1
    Related PDB Ids 3b4s 
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6031,NP_799930.1, 223926 Molecular Weight 10490.44 Da.
    Residues 91 Isoelectric Point 5.26
    Sequence dgrifkmfiehlefekgldafsqswikaledseflailrllfhhivtsesahefaangidrlykmvesq fgsggdkelewligrsliqmsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.20 Rfree 0.26112
    Matthews' coefficent 4.02 Rfactor 0.22306
    Waters Solvent Content 69.43

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3ljl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch