The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative DNA binding protein from Methanocaldococcus jannaschii. To be Published
    Site MCSG
    PDB Id 3lhk Target Id APC63340.1
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS31491,AAB97992.1,, 243232 Molecular Weight 17791.86 Da.
    Residues 151 Isoelectric Point 9.46
    Sequence kiigyarvsfnaqkddlerqiqliksyaeengwdiqilkdigsglnekrknykkllkmvmnrkvekvii aypdrltrfgfetlkeffksygteiviinkkhktpqeelvedlitivshfagklygmhshkykkltktv keivreedakeke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.24927
    Matthews' coefficent 2.64 Rfactor 0.20347
    Waters 282 Solvent Content 53.35

    Ligand Information


    Google Scholar output for 3lhk

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch