.
The Open Protein Structure Annotation Network
PDB Keyword
.

3leq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Roadblock/LC7 domain from Streptomyces avermitillis to 1.85A. To be Published
    Site MCSG
    PDB Id 3leq Target Id APC65473.1
    Molecular Characteristics
    Source Streptomyces avermitilis ma
    Alias Ids TPS31516,NP_823365.1, 3.30.450.110, 227882 Molecular Weight 13305.67 Da.
    Residues 126 Isoelectric Point 6.84
    Sequence thsqldqlltglvdrvaevdhavvlsedglvvskstgflrddaerlaatasglmslskgvsmdfrrgpv rqaliemgkgyliltaagpgahlvvltrqgadvgvvayqmnmlvkkigehlsapprg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.23588
    Matthews' coefficent 1.94 Rfactor 0.21592
    Waters 37 Solvent Content 36.52

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3leq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch