.
The Open Protein Structure Annotation Network
PDB Keyword
.

3led

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 3-oxoacyl-(acyl carrier protein) synthase III from Rhodopseudomonas palustris CGA009. To be Published
    Site MCSG
    PDB Id 3led Target Id APC65203
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS31511,NP_946649.1, 3.40.47.10, 258594 Molecular Weight 40267.55 Da.
    Residues 371 Isoelectric Point 5.60
    Sequence mrpaviaatglytppdsvsnaelveafntyvanfnaankarieageieplqpsssefiekasgiksryv vakpgivdpdvmrpiipersndelsilaemavtaaeqaierwgkprerigavlcacsnmqraypamaie vqnalglggfafdmnvacssatfglktaadfvgggsvdavlmvnpeicsghlnfrdrdshfifgdvata aiveraddaqggwsilgtklktqfsnnirnnagflnrawpegrdkadklfvqqgrkvfkevvplvsemi iehareigidphglkrmwlhqaninmneiigrkvlgrdptrdenviilddyantssagsiiafhkhqdd maqgdlglicsfgagysagtvfvqkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.16843
    Matthews' coefficent 2.23 Rfactor 0.14473
    Waters 1298 Solvent Content 44.86

    Ligand Information
    Ligands FMT (FORMIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3led

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch