.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lec

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a protein in the NADB-Rossmann Superfamily from Streptococcus agalactiae to 1.8A. To be Published
    Site MCSG
    PDB Id 3lec Target Id APC63914
    Molecular Characteristics
    Source Streptococcus agalactiae 2603v
    Alias Ids TPS31497,AAN00085.1, 3.40.50.150, 208435 Molecular Weight 25638.92 Da.
    Residues 227 Isoelectric Point 5.10
    Sequence mdlqlskrlqkvanyvpkgarlldvgsdhaylpifllqmgycdfaiagevvngpyqsalknvsehglts kidvrlanglsafeeadnidtiticgmggrliadilnndidklqhvktlvlqpnnreddlrkwlaandf eivaediltendkryeilvvkhghmnltakelrfgpfllsnnttvfkekwqnelnkltfalnsipnskm eerailedkiqdikevldes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.248
    Matthews' coefficent 2.04 Rfactor 0.207
    Waters 118 Solvent Content 39.60

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 3lec

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch