.
The Open Protein Structure Annotation Network
PDB Keyword
.

3laz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the N-terminal domain of D-galactarate dehydratase from Escherichia coli CFT073. To be Published
    Site MCSG
    PDB Id 3laz Target Id APC38252.2
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS31450,AAN82324.1, PF04292.2.HMM.1, 199310 Molecular Weight 10576.59 Da.
    Residues 96 Isoelectric Point 5.21
    Sequence manikirqetptafyikvhdtdnvaiivndnglkagtrfpdgleliehipqghkvalldipangeiiry gevigyavraiprgswidesmvvlpea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.92 Rfree 0.2451
    Matthews' coefficent 3.31 Rfactor 0.2033
    Waters 81 Solvent Content 62.86

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3laz

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch