The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown protein RPA4178 from Rhodopseudomonas palustris CGA009. To be Published
    Site MCSG
    PDB Id 3lag Target Id APC6210
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5035,NP_949514.1, 258594 Molecular Weight 10402.21 Da.
    Residues 95 Isoelectric Point 5.46
    Sequence mtvaakseiqidndevrvtewrlppgsatghhthgmdyvvvpmadgemtivapdgtrslaqlktgrsya rkagvqhdvrnestaeivfleielka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.15 Rfree 0.2205
    Matthews' coefficent 1.92 Rfactor 0.1854
    Waters 354 Solvent Content 35.97

    Ligand Information
    Ligands FMT (FORMIC) x 3
    Metals NI (NICKEL) x 2;CA (CALCIUM) x 1


    Google Scholar output for 3lag

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch