The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a functionally unknown conserved protein from Haemophilus influenzae Rd KW20. To be Published
    Site MCSG
    PDB Id 3lae Target Id APC85784.2
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS5786,AAC21785.1, PF03471, 71421 Molecular Weight 8744.48 Da.
    Residues 78 Isoelectric Point 4.16
    Sequence iqqsdgsmiidgsanlrdlnkmfnweldtedartfnglilehleeipdegticeidgllitilevgdnm ikqakvvkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.45 Rfree 0.2222
    Matthews' coefficent 2.07 Rfactor 0.1641
    Waters 71 Solvent Content 40.49

    Ligand Information
    Ligands ILE-PHE-GLY (PHOSPHATE) x 1;PO4 (1,2-ETHANEDIOL) x 1;EDO x 3


    Google Scholar output for 3lae

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch