.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kzv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a cytoplasmic protein with unknown function from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 3kzv Target Id APC7728
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS31416,NP_012301.1, 4932 Molecular Weight 27479.09 Da.
    Residues 254 Isoelectric Point 5.95
    Sequence mgkvilvtgvsrgigksivdvlfsldkdtvvygvarseaplkklkekygdrffyvvgditedsvlkqlv naavkghgkidslvanagvlepvqnvneidvnawkklydinffsivslvgialpelkktngnvvfvssd acnmyfsswgaygsskaalnhfamtlaneerqvkaiavapgivdtdmqvnirenvgpssmsaeqlkmfr glkennqlldssvpatvyaklalhgipdgvngqylsyndpaladfmp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24461
    Matthews' coefficent 2.80 Rfactor 0.19133
    Waters 130 Solvent Content 56.12

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3kzv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch