The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative diguanylate cyclase/phosphodiesterase from Listaria monocytigenes. To be Published
    Site MCSG
    PDB Id 3kzp Target Id APC7867
    Molecular Characteristics
    Source Listeria monocytogenes egd
    Alias Ids TPS31425,NP_463644.1, 169963 Molecular Weight 27230.19 Da.
    Residues 235 Isoelectric Point 5.27
    Sequence mglmkfqlfiqpkldvlqgniveyeillrddsavprfplseleavladeelylafsewfseafldvlkk ypndrfainiapqqlfyietlhwldklkseshritvemtedifdvpghkrhlnandknafilnkikvih glgyhiaiddvscglnslervmsylpyiieikfslihfknipledlllfikawanfaqknkldfvvegi etketmtlleshgvsifqgylvnkpfpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.41 Rfactor 0.185
    Waters 408 Solvent Content 48.87

    Ligand Information
    Ligands CAC (CACODYLATE) x 2
    Metals CL (CHLORIDE) x 6;CA (CALCIUM) x 2


    Google Scholar output for 3kzp

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch