The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Sugar-Binding Domain of Transcriptional Repressor from Vibrio fischeri. To be Published
    Site MCSG
    PDB Id 3kv1 Target Id APC38671.1
    Molecular Characteristics
    Source Vibrio fischeri es114
    Alias Ids TPS31451,AAW87470.1, PF04198.2.HMM.5, 312309 Molecular Weight 28684.10 Da.
    Residues 264 Isoelectric Point 5.74
    Sequence fhpvysvqleqklvekfnlkralisldqpntneqrkqvaalvssylnnnlqegmavavgqgqnvaavad hagivtqrnarfvsaiggthrsgdiinadhicrrlakkyggssetlyapayvndpslrsafmehatike tlsqarkaefalvgigdmdenshmvklgfftpkefvearlndgivgdiggfdffkldgtdadtlmrgrv iglemedlrqipnvvamasesrkalsimgalrtgvidvlatsvscamallnlaenee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.201
    Matthews' coefficent 2.20 Rfactor 0.165
    Waters 166 Solvent Content 44.18

    Ligand Information
    Ligands GOL (GLYCEROL) x 5


    Google Scholar output for 3kv1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch