.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kty

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Probable Methyltransferase SpoU from Bordetella pertussis Tohama I. To be Published
    Site MCSG
    PDB Id 3kty Target Id APC62466.2
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS31481,CAE42183.1, 3.40.1280.10, 257313 Molecular Weight 18185.90 Da.
    Residues 170 Isoelectric Point 5.92
    Sequence mtqafsrvrfimtqpshpgnvgsaaraiktmgfgelvlvaprfpdmtaqpeavalasgaldvleraavh dtleealapvtlafalttrvrdlgpppcdireaaglarrhlddteagvvaivlgteragltnaqielch richipanpqysslnvaqalqlaawelryall
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.240
    Matthews' coefficent 2.30 Rfactor 0.187
    Waters 128 Solvent Content 46.41

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kty

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch