.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kmi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative membrane protein from Clostridium difficile 630. To be Published
    Site MCSG
    PDB Id 3kmi Target Id APC38194.1
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS31448,CAJ69935.1, PF06081.1.HMM.4, 272563 Molecular Weight 20231.15 Da.
    Residues 174 Isoelectric Point 5.51
    Sequence ptnihkihevqkklqeevsivlidiadiivnpkkengysrdlytlnslidssisetydninntllsdtr fflehmdiiksqrdilenlysyvsqlnstppqahilsafihkigytefeaetgnllleelkrlmismkn qplpvdrtefenrailflcltelkqflvnrkhaqml
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.23526
    Matthews' coefficent 2.03 Rfactor 0.19055
    Waters 294 Solvent Content 39.54

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;FMT (FORMIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3kmi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch