.
The Open Protein Structure Annotation Network
PDB Keyword
.

3keb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of thiol peroxidase from Chromobacterium violaceum. To be Published
    Site MCSG
    PDB Id 3keb Target Id APC40679
    Molecular Characteristics
    Source Chromobacterium violaceum atcc 12472
    Alias Ids TPS31461,NP_903378.1, 243365 Molecular Weight 25052.84 Da.
    Residues 220 Isoelectric Point 5.04
    Sequence medfwvqygdemlpvigdfprkgdylpsfmlvddqkhdaalesfshtpklivtllsvdedehagllllr etrrfldswphlklivitvdspsslararhehglpniallstlrgrdfhkrygvliteyplsgytspai iladaanvvhyserlantrdffdfdaiekllqegeqqamaaereaaearqeqdaerekgterllekakl iqdqlnrngdpgr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.242
    Matthews' coefficent 2.00 Rfactor 0.206
    Waters 761 Solvent Content 38.52

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3keb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch