.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kdq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a functionally unknown conserved protein from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3kdq Target Id APC82872
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5692,CAE50515.1, 1717 Molecular Weight 17598.86 Da.
    Residues 151 Isoelectric Point 5.19
    Sequence mylaealaqrveaqrryselnqllldvakvqegdqpaenpheilteleelttrindlvrrinrtnsvte fsegmtladalsvrdallkkrtlysdladqltsrqdrysrseikyvatmdareirkkadlaakeyrqld vdiqrlnwqtelq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.00 Rfree 0.2643
    Matthews' coefficent 3.14 Rfactor 0.1971
    Waters Solvent Content 60.87

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3kdq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch