.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kbr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of cyclohexadienyl dehydratase precursor from Pseudomonas aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 3kbr Target Id APC37816.1
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS31443,NP_252165.1, 208964 Molecular Weight 27046.29 Da.
    Residues 236 Isoelectric Point 5.62
    Sequence qesrldrilesgvlrvattgdykpfsyrteeggyagfdvdmaqrlaeslgaklvvvptswpnlmrdfad drfdiamsgisinlerqrqayfsipylrdgktpitlcseearfqtleqidqpgvtaivnpggtnekfar anlkkarilvhpdnvtifqqivdgkadlmmtdaiearlqsrlhpelcavhpqqpfdfaekayllprdea fkryvdqwlhiaeqsgllrqrmehwleyr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.2131
    Matthews' coefficent 2.47 Rfactor 0.1827
    Waters 163 Solvent Content 50.30

    Ligand Information
    Ligands GOL (GLYCEROL) x 5;FMT (FORMIC) x 2;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals NI (NICKEL) x 1;CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3kbr
    1. Structure of aldose reductase from Giardia lamblia
    M Ferrell, J Abendroth, Y Zhang - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch