.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kao

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tagatose 1,6-diphosphate aldolase from Staphylococcus aureus. To be Published
    Site MCSG
    PDB Id 3kao Target Id APC63827
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS31496,BAB58354.1, 3.20.20.70, 158878 Molecular Weight 36593.52 Da.
    Residues 326 Isoelectric Point 5.04
    Sequence msksnqkiasieqlsnnegiisalafdqrgalkrmmakhqteeptvaqieqlkvlvaeeltqyassill dpeyglpasdarnkdcglllayektgydvnakgrlpdclvewsakrlkeqganavkfllyydvddaeei niqkkayierigsecvaedipfflevltyddnipdngsvefakvkprkvneamklfseprfnvdvlkve vpvnmkyvegfaegevvytkeeaaqhfkdqdaathlpyiylsagvsaelfqetlkfaheagakfngvlc gratwsgavqvyieqgedaarewlrttgfkniddlnkvlkdtatswkqrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.17098
    Matthews' coefficent 4.90 Rfactor 0.14821
    Waters 402 Solvent Content 74.87

    Ligand Information
    Ligands SO4 (SULFATE) x 3;GOL (GLYCEROL) x 3
    Metals ZN (ZINC) x 3

    Jmol

     
    Google Scholar output for 3kao

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch