.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k6a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Molybdenum Cofactor Biosynthesis Protein Mog from Shewanella Oneidensis. To be Published
    Site MCSG
    PDB Id 3k6a Target Id APC84718
    Related PDB Ids 2f7y 2f7w 
    Molecular Characteristics
    Source Shewanella oneidensis mr-1
    Alias Ids TPS5742,NP_715707, 211586 Molecular Weight 19327.23 Da.
    Residues 177 Isoelectric Point 4.66
    Sequence mskakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikmadeqdccl ivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtaglrgdslivnlpgkpks irecldavfpaipycidlmegpylecneavikpfrpkak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.89 Rfree 0.21633
    Matthews' coefficent 2.29 Rfactor 0.17684
    Waters 893 Solvent Content 46.25

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 3k6a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (2)

    FileSizeDateAttached by 
    2f7w.png
    No description
    35.26 kB22:13, 30 Jun 2008dweekesActions
    2f7y.png
    No description
    39.5 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch