.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k32

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of predicted subunit of tRNA methyltransferase from Methanocaldococcus jannaschii DSM. To be Published
    Site MCSG
    PDB Id 3k32 Target Id APC60785
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS31464,AAB98685.1, 3.40.50.620, 243232 Molecular Weight 22903.50 Da.
    Residues 200 Isoelectric Point 9.02
    Sequence mklmdvhvlfsggkdsslsavilkklgynphlitinfgvipsyklaeetakilgfkhkvitldrkivek aadmiiehkypgpaiqyvhktvleiladeysiladgtrrddrvpklsyseiqslemrkniqyitplmgf gyktlrhlaseffileeiksgtklssdyeaeirhilkergespekyfpehkqtrvvglkkei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.50 Rfree 0.2631
    Matthews' coefficent 2.25 Rfactor 0.1769
    Waters 252 Solvent Content 45.42

    Ligand Information
    Ligands GOL (GLYCEROL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3k32

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch