.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k2v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the CBS pair of a putative D-arabinose 5-phosphate isomerase from Klebsiella pneumoniae subsp. pneumoniae. TO BE PUBLISHED
    Site MCSG
    PDB Id 3k2v Target Id APC63101.1
    Molecular Characteristics
    Source Klebsiella pneumoniae subsp. pneumoniae mgh 78578
    Alias Ids TPS31488,ABR79000.1, 3.20.20.70, 272620 Molecular Weight 17776.49 Da.
    Residues 166 Isoelectric Point 5.35
    Sequence ptssttaalvmgdalavalleargftaedfalshpggalgrklllrvndimhtgdeiphvglqatlrda lleitrknlgmtaicdddmniigiftdgdlrrvfdtgvdmrdasiadvmtrggirirpgtlavdalnlm qsrhitcvlvadgdhllgvvhmhdllra
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.182
    Matthews' coefficent 3.27 Rfactor 0.156
    Waters 289 Solvent Content 62.33

    Ligand Information
    Ligands CMK (CYTIDINE) x 2;SO4 (SULFATE) x 1;GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3k2v
    1. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch