.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k0b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a predicted N6-adenine-specific DNA methylase from Listeria monocytogenes str. 4b F2365. To be Published
    Site MCSG
    PDB Id 3k0b Target Id APC64818
    Molecular Characteristics
    Source Listeria monocytogenes str. 4b f2365
    Alias Ids TPS31510,AAT04685.1, 3.40.50.150, 265669 Molecular Weight 43035.99 Da.
    Residues 382 Isoelectric Point 6.00
    Sequence mksfqlvataasgleaivgkevarlgydpkvengkvyfegdlsaiaranlwlrvadrvkivvgvfkatt fdelfektkalpwedylpldaqfpvagksvkstlysvpdcqaivkkaivnrvsekyrrsgrlmetgalf klevsilkdevtltidtsgaglhkrgyrlaqgsapiketmaaalvlltswhpdrpfydpvcgsgtipie aaligqniapgfnrefvsetwdwmpkqvwadarqeaedlanydqplniiggdidarlieiakqnaveag lgdlitfrqlqvadfqtedeygvvvanppygerledeeavrqlyremgivykrmptwsvyvltsyelfe evygkkatkkrklyngylrtdlyqywgprkprpkked
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.19771
    Matthews' coefficent 2.24 Rfactor 0.16417
    Waters 520 Solvent Content 45.17

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3k0b
    1. Crystal structures of the tRNA: m2G6 methyltransferase Trm14/TrmN from two domains of life
    M Fislage, M Roovers, I Tuszynska - Nucleic Acids , 2012 - Oxford Univ Press
     
    2. Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
    KT Wang, B Desmolaize, J Nan, XW Zhang - Nucleic Acids , 2012 - Oxford Univ Press
     
    3. PoSSuM: a database of similar proteinligand binding and putative pockets
    JI Ito, Y Tabei, K Shimizu, K Tsuda - Nucleic Acids , 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch