The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of alpha chain of probable 2-oxoacid ferredoxin oxidoreductase from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 3ju3 Target Id APC36729.1
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS31439,CAC11904.1,, 2303 Molecular Weight 12920.26 Da.
    Residues 115 Isoelectric Point 5.19
    Sequence ekavligekeaditfvtwgsqkgpildviedlkeegisanllylkmfspfptefvknvlssanlvidve snytaqaaqmiklytgidiknkilkyngrhmtedeilksakeilnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.23631
    Matthews' coefficent 1.97 Rfactor 0.19765
    Waters 89 Solvent Content 37.50

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1


    Google Scholar output for 3ju3

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch