.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ix7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a domain of functionally unknown protein from Thermus thermophilus HB8. To be Published
    Site MCSG
    PDB Id 3ix7 Target Id APC64134.1
    Molecular Characteristics
    Source Thermus thermophilus hb8
    Alias Ids TPS31505,BAD70363.1, 3.40.50.1010, 300852 Molecular Weight 14424.90 Da.
    Residues 131 Isoelectric Point 6.38
    Sequence prggkvldtsvlvdgrvaevaavgflegplwvphfvlkelqhfadsqdplrrakgrrgletlerlreaa plevlettpkgesvdekllflardleaalvtndhallqmariygvkalsiqalaqalrpqlq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.25609
    Matthews' coefficent 2.33 Rfactor 0.20936
    Waters 142 Solvent Content 47.10

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 3ix7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch