.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iwf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the N-terminal domain of a RpiR Transcriptional Regulator from Staphylococcus epidermidis to 1.4A. To be Published
    Site MCSG
    PDB Id 3iwf Target Id APC86334.3
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS31522,AAO05532.1, PF01418, 176280 Molecular Weight 12317.60 Da.
    Residues 107 Isoelectric Point 9.70
    Sequence mpnilykidnqypyftknekkiaqfilnyphkvvnmtsqeianqletsstsiirlskkvtpggfnelkt rlskflpkevtqynvelvdnestislknklhsrskaal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.205
    Matthews' coefficent 2.32 Rfactor 0.177
    Waters 168 Solvent Content 47.03

    Ligand Information
    Ligands MXE (2-METHOXYETHANOL) x 2;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 2
    Metals NI (NICKEL) x 2;CL (CHLORIDE) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 3iwf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch