.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ivp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a possible transposon-related DNA-binding protein from Clostridium difficile 630. To be Published
    Site MCSG
    PDB Id 3ivp Target Id APC62618
    Molecular Characteristics
    Source Clostridium difficile 630
    Alias Ids TPS31482,CAJ70227.1, 272563 Molecular Weight 13428.74 Da.
    Residues 118 Isoelectric Point 6.60
    Sequence mrkkedkydfralglaikearkkqgltreqvgamieidpryltnienkgqhpslqvlydlvsllnvsvd efflpassqvkstkrrqlenkidnftdadlvimesvadgivkskevgem
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.02 Rfree 0.23498
    Matthews' coefficent 2.52 Rfactor 0.19968
    Waters 136 Solvent Content 51.17

    Ligand Information
    Ligands PG4 (TETRAETHYLENE) x 3
    Metals

    Jmol

     
    Google Scholar output for 3ivp
    1. Cleavable C-terminal His-tag vectors for structure determination
    WH Eschenfeldt, N Maltseva, L Stols - Journal of structural and , 2010 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch