.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iv6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Zn-dependent Alcohol Dehydrogenases from Rhodobacter sphaeroides. To be Published
    Site MCSG
    PDB Id 3iv6 Target Id APC63723
    Molecular Characteristics
    Source Rhodobacter sphaeroides 2.4.1
    Alias Ids TPS31493,ABA81626.1, 3.40.50.150, 272943 Molecular Weight 28950.25 Da.
    Residues 258 Isoelectric Point 5.09
    Sequence mtitnskaeawelignqfwtigrvaarpsdrendiflenivpgstvavigastrfliekalergasvtv fdfsqrmcddlaealadrcvtidllditaeipkelaghfdfvlndrlinrftteearraclgmlslvgs gtvrasvklgfydidlklieygeqsgtlakffdpsdktfhfreagdvldralvphglidkptllewyrr rgketrfddedvrallshdvvnargyvtlekavelpdapntmlyqfsrrag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.70 Rfree 0.2380
    Matthews' coefficent 2.88 Rfactor 0.176
    Waters 252 Solvent Content 57.27

    Ligand Information
    Ligands SAM (S-ADENOSYLMETHIONINE) x 4
    Metals CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3iv6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch