.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iv3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of a putative tagatose 1,6-aldolase from Streptococcus mutans. TO BE PUBLISHED
    Site MCSG
    PDB Id 3iv3 Target Id APC63936
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS31498,AAN57897.1, 3.20.20.70, 210007 Molecular Weight 36556.56 Da.
    Residues 329 Isoelectric Point 4.80
    Sequence milsqqkynylakvsdsngvisalafdqrgalkclmaqyqmkeptvaqmeelkvlvseeltpyassill dpeyglpaaqardreaglllayektgydanttsrlpdclvdwsikrlkeagadavkfllyydvdgdpqv nvqkqayierigsecqaedipffleiltydetisnnssvefakvkvhkvndamkvfsaerfgidvlkve vpvnmvyvegfaegevvyskeeaaqafreqeastdlpyiylsagvsaelfqetlvfahkagakfngvlc gratwagsvqvymeegkeaarqwlrtsglqninelnkvlkttaspwtekvsvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.176
    Matthews' coefficent 2.96 Rfactor 0.153
    Waters 362 Solvent Content 58.51

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EDO (1,2-ETHANEDIOL) x 8
    Metals K (POTASSIUM) x 2

    Jmol

     
    Google Scholar output for 3iv3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch