.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iru

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phoshonoacetaldehyde hydolase like protein from Oleispira antarctica. To be Published
    Site MCSG
    PDB Id 3iru Target Id APC40629
    Molecular Characteristics
    Source Oleispira antarctica
    Alias Ids TPS31458,OLEI04073, 188908 Molecular Weight 30106.66 Da.
    Residues 275 Isoelectric Point 5.08
    Sequence mlkanvfcagpvealildwagttidfgslapvyafmelfkqegievtqaearepmgteksehirrmlgn srianawlsikgqasneedikrlydlfapiqtrivaqrsqlipgwkevfdkliaqgikvggntgygpgm mapaliaakeqgytpastvfatdvvrgrpfpdmalkvalelevghvngcikvddtlpgieeglragmwt vgvscsgnevgldredwqalssdeqqsyrqhaeqrlfnagahyvidsvadletvitdvnrrlargekp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.24542
    Matthews' coefficent 3.37 Rfactor 0.20396
    Waters 185 Solvent Content 63.49

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3iru

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch