.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ir9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of C-terminal domain of Peptide Chain Release Factor from Methanosarcina mazei. To be Published
    Site MCSG
    PDB Id 3ir9 Target Id APC36528.1
    Molecular Characteristics
    Source Methanosarcina mazei go1
    Alias Ids TPS31438,AAM31043.1, 3.30.1330.30, 192952 Molecular Weight 17719.83 Da.
    Residues 163 Isoelectric Point 4.52
    Sequence ytdesglselvnaageklqdlelmgqknavrdffkeliadsgkvaygesqvranleinsvdvlllsedl raervttkcsvcgyenkwtrrwkpgepapaagncpkcgsslevtdvtdivdefseladksnakvvfvst dfdegsqlmnafggiaailryntgv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.2034
    Matthews' coefficent 2.56 Rfactor 0.1559
    Waters 36 Solvent Content 51.97

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3ir9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch