The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the aminopeptidase P,XAA-pro aminopeptidase from Streptococcus thermophilus. To be Published
    Site MCSG
    PDB Id 3il0 Target Id APC64015.1
    Molecular Characteristics
    Source Streptococcus thermophilus lmg 18311
    Alias Ids TPS31500,AAV61341.1, 3.40.350.10, 264199 Molecular Weight 14916.33 Da.
    Residues 128 Isoelectric Point 5.80
    Sequence mqrrlerfdaklvqsgldallvtgqnniyyltdfwgtnatvfitknrrlfltdsrytliakqsvhgfdi ieskdplkdivkfvevdkletigfdnqvsfayyqalqaifegytlspqtnfmeelrmik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.23688
    Matthews' coefficent 2.89 Rfactor 0.20132
    Waters 64 Solvent Content 57.39

    Ligand Information
    Ligands GOL (GLYCEROL) x 2


    Google Scholar output for 3il0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch