The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a conserved protein from Streptococcus mutans UA159. To be Published
    Site MCSG
    PDB Id 3ikb Target Id APC63946
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS31499,AAN58923.1, 3.40.470.10, 210007 Molecular Weight 22603.88 Da.
    Residues 195 Isoelectric Point 9.20
    Sequence mtsleeitkaimadsqnkvfteknieplfaapktarinivgqapgikaqesrlywndksgdrlrewmgv dydtfyhsgyfavipmdfyypgkgksgdlpprkgfaqkwhqpildllpdiqltilignyaqkyylhqks svkltdtvahykkylpdyfplvhpsprnqiwmsrhpwfeaqvvpdlkkiiqqiiqss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.67 Rfree 0.21421
    Matthews' coefficent 2.35 Rfactor 0.18460
    Waters 450 Solvent Content 47.74

    Ligand Information
    Ligands FLC (CITRATE) x 3


    Google Scholar output for 3ikb

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch