The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative zinc protease from Bordetella pertussis Tohama I. To be Published
    Site MCSG
    PDB Id 3ih6 Target Id APC62458.3
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS31480,CAE42769.1, 3.30.830.10, 257313 Molecular Weight 21298.94 Da.
    Residues 194 Isoelectric Point 5.46
    Sequence ytvepvqdgersvtlrraggtplvaamyhlpaagspdfvgldlaatiladtpssrlyhalvptklasgv fgftmdqldpglamfgaqlqpgmdqdkalqtltatleslsskpfsqeelerarskwltawqqtyadpek vgvalseaiasgdwrlfflqrdrvreaklddvqraavaylvrsnrtegryiptekp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.15 Rfree 0.26830
    Matthews' coefficent 2.13 Rfactor 0.20712
    Waters 701 Solvent Content 42.28

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 3;ACT (ACETATE) x 1


    Google Scholar output for 3ih6

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch