The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Ribosomal-protein-S5-alanine Acetyltransferase from Vibrio fischeri to 2.0A. To be Published
    Site MCSG
    PDB Id 3igr Target Id APC61240.1
    Molecular Characteristics
    Source Vibrio fischeri es114
    Alias Ids TPS31466,AAW87820.1, 3.40.630.30, 312309 Molecular Weight 21564.71 Da.
    Residues 184 Isoelectric Point 9.42
    Sequence mdvsfefehyqvrlikssdavtianyfmrnrhhlapwepkrshafftpegwkqrllqlvelhkhnlafy fvvvdknehkiigtvsysnitrfpfhaghvgysldseyqgkgimrravnvtidwmfkaqnlhrimaayi prneksakvlaalgfvkegeakkylyingawedhiltskinddwkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.237
    Matthews' coefficent 2.87 Rfactor 0.205
    Waters 143 Solvent Content 57.20

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals NA (SODIUM) x 3


    Google Scholar output for 3igr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch