.
The Open Protein Structure Annotation Network
PDB Keyword
.

3idf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a USP-like protein from Wolinella succinogenes to 2.0A. To be Published
    Site MCSG
    PDB Id 3idf Target Id APC61286
    Molecular Characteristics
    Source Wolinella succinogenes
    Alias Ids TPS31470,CAE09945.1, 3.40.50.620, 844 Molecular Weight 15700.38 Da.
    Residues 138 Isoelectric Point 4.65
    Sequence mkkllfaiddteaceraaqyildmfgkdadctltlihvkpefmlygeavlaaydeiemkeeekaklltq kfstfftekginpfvvikegepvemvleeakdynlliigssensflnkifashqddfiqkapipvlivk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.217
    Matthews' coefficent 3.14 Rfactor 0.182
    Waters 89 Solvent Content 60.82

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3idf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch