.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ic7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Transcriptional Regulator of GntR Family from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 3ic7 Target Id APC88470
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5911,NP_810217.1, PF00392.11, 226186 Molecular Weight 14552.95 Da.
    Residues 123 Isoelectric Point 5.90
    Sequence mnfkesraiylqiadricddillgqyeeegripsvreyasivevnantvmrsyeylqsqeviynkrgig ffvasgakmlihslrkeqflkeevgsffrqlytlgisikeiekmyyefiqrqnq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.82 Rfree 0.2630
    Matthews' coefficent 2.81 Rfactor 0.236
    Waters 28 Solvent Content 56.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ic7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch