The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the glutaredoxin from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 3ic4 Target Id APC40496
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS31457,AAB89710.1, 224325 Molecular Weight 9418.55 Da.
    Residues 82 Isoelectric Point 6.83
    Sequence maevlmyglstcphckrtleflkregvdfeviwidklegeerkkviekvhsisgsysvpvvvkgdkhvl gyneeklkelirg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23865
    Matthews' coefficent 2.17 Rfactor 0.19490
    Waters 81 Solvent Content 43.26

    Ligand Information
    Metals MG (MAGNESIUM) x 2


    Google Scholar output for 3ic4

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch