.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ibs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein BatB from Bacteroides thetaiotaomicron. To be Published
    Site MCSG
    PDB Id 3ibs Target Id APC36284.2
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS31435,AAO76013.1, 3.40.50.410, 226186 Molecular Weight 22669.56 Da.
    Residues 212 Isoelectric Point 5.14
    Sequence vkrkgveviialdisnsmlaqdvqpsrlekakrlisrlvdeldndkvgmivfagdaftqlpitsdyisa kmflesispsliskqgtaigeainlatrsftpqegvgraiivitdgenheggaveaakaaaekgiqvsv lgvgmpegapipvegtndyrrdregnvivtrlnegmcqeiakdgkgiyvrvdnsnsaqkaisqeiskma ksdve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.21941
    Matthews' coefficent 2.54 Rfactor 0.18246
    Waters 171 Solvent Content 51.49

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 9

    Jmol

     
    Google Scholar output for 3ibs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch