The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A domain of a functionally unknown protein from Methanocaldococcus jannaschii DSM 2661. To be Published
    Site MCSG
    PDB Id 3i8o Target Id APC89320.5
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS31532,AAB99554.1,, 243232 Molecular Weight 15791.27 Da.
    Residues 139 Isoelectric Point 4.80
    Sequence kkvcvdtcvvidgriteliergklkdatiiipeavvseleyqanmgreigykgieelrkliekasehni kveyygerptreeiflaksgeidamirkvaketnsilltsdwiqynlakaqgieayfleaaeeevelvld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.64 Rfree 0.2587
    Matthews' coefficent 2.88 Rfactor 0.1921
    Waters 5 Solvent Content 57.36

    Ligand Information
    Metals CL (CHLORIDE) x 1


    Google Scholar output for 3i8o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch