The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative inorganic pyrophosphatase from the oil-degrading bacterium Oleispira antarctica. To be Published
    Site MCSG
    PDB Id 3i4q Target Id APC40078
    Molecular Characteristics
    Source Unknown organism
    Alias Ids TPS31454,OLEI03685_1_175 Molecular Weight 19333.95 Da.
    Residues 175 Isoelectric Point 4.66
    Sequence mgyntipagkdlpndiyvaieipanaspikyeidkdmdallvdrfmatpmfypanygyinntladdgda ldvlvitpypvapgsvirarpvgvlkmsdeaggdekllavphekltqlyndihdiddvpqllkdqivhf fehykdlekgkwvkvegwenadaaraaivksaaaykg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.21227
    Matthews' coefficent 2.23 Rfactor 0.17387
    Waters 174 Solvent Content 44.82

    Ligand Information
    Metals NA (SODIUM) x 2


    Google Scholar output for 3i4q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch