.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hsi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphatidylserine synthase Haemophilus influenzae Rd KW20. To be Published
    Site MCSG
    PDB Id 3hsi Target Id APC63002
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS28170,AAC22084.1, 3.30.870.10, 71421 Molecular Weight 53077.16 Da.
    Residues 455 Isoelectric Point 8.14
    Sequence mlinktkraeqnlnnlpflalqaeqieflgssaefktqiielirnakkriyvtalywqkdeagqeilde iyrvkqenphldvkvlidwhraqrnllgaeksatnadwyceqrqtyqlpddpnmffgvpintrevfgvl hvkgfvfddtvlysgasinnvylhqfekyrydryqkithaeladsmvnfindylldfsavypldvtnrp rtkeirgnirayrkdlaqngeyslksavklpnvlsvsplfglgasgnelnqviedlflqvqkklvictp yfnfprtlqhkiatllengkrveiivgdkvandfyippeqpfkmagalpylyesnlrrfcekfetqies gqlvvrlwrdgdntyhlkgvwvddryilltgnnlnprawrldaenglliydpqqqllaqvekeqnqirq htkvlkhyteleelnqypepvqkllkkfarikadklvkmil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.23608
    Matthews' coefficent 2.63 Rfactor 0.18999
    Waters 649 Solvent Content 53.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hsi

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch