.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hlu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Uncharacterized Protein Conserved in Bacteria DUF2179 from Eubacterium ventriosum. To be Published 2009
    Site MCSG
    PDB Id 3hlu Target Id APC21004.1
    Molecular Characteristics
    Source Eubacterium ventriosum atcc 27560
    Alias Ids TPS28145,B3BCYFDMORQPHSGKJG8+KVZITF4, 411463 Molecular Weight 10516.72 Da.
    Residues 93 Isoelectric Point 5.07
    Sequence ngdqqtmvyivsakrkiiadrmlqeldlgvtmlqavgayknnetevimcvmrkatlvkvrnllkevdpd afmivstanevfgegfknqyetei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.252
    Matthews' coefficent 3.74 Rfactor 0.226
    Waters 26 Solvent Content 67.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3hlu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch