.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hhh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transcriptional regulator, a membar of PadR family, from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3hhh Target Id APC29037
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5431,AAO81089, 226185 Molecular Weight 13161.77 Da.
    Residues 113 Isoelectric Point 9.45
    Sequence mkqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwviaekkpsekg pmrkfyrltssgeaeladfwqrwtllskqvnkmkknggiehvkf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.26269
    Matthews' coefficent 2.26 Rfactor 0.22088
    Waters 9 Solvent Content 45.51

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3hhh
    1. Antigen binding proteins to proprotein convertase subtilisin kexin type 9 (PCSK9)
    SM Jackson, B Shan, W Shen, CT King - US Patent 8,030,457, 2011 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch