.
The Open Protein Structure Annotation Network
PDB Keyword
.

3he0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of a Putative Transcriptional Regulator TetR Family Protein from Vibrio parahaemolyticus. TO BE PUBLISHED
    Site MCSG
    PDB Id 3he0 Target Id APC91430
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS28190,NP_796419.1, PF00440.13, 223926 Molecular Weight 21594.25 Da.
    Residues 193 Isoelectric Point 5.04
    Sequence mtdnpavdkrdqilaaaeqliaesgfqglsmqklaneagvaagtiyryfsdkehlleevrlnvakrias avqagvnddmplkecyrtmwlniwnlagsnlnaisnrvqydslpcttrnktwelerkmfaqvdrlfnqg keegvfkpldnevlsglsfeasvalarkhalgfyqldddaleaaieaswdaiikh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.227
    Matthews' coefficent 2.40 Rfactor 0.187
    Waters 242 Solvent Content 48.82

    Ligand Information
    Ligands SO4 (SULFATE) x 7;GOL (GLYCEROL) x 6
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3he0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch