.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hdj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of probable ornithine cyclodeaminase from Bordetella pertussis Tohama I. To be Published
    Site MCSG
    PDB Id 3hdj Target Id APC62486
    Molecular Characteristics
    Source Bordetella pertussis tohama i
    Alias Ids TPS28166,CAE44686.1, 3.40.50.720, 257313 Molecular Weight 32297.99 Da.
    Residues 310 Isoelectric Point 6.54
    Sequence mlhiddamiedavtpqaaqevlhaafldfgrgsaamqrrvrteaggvklstlgavipgqgvagakvytt ikgqfqfvillfsaadgrplatcdagtltrkrtaactvlaagalarprssvlglfgagtqgaehaaqls arfaleailvhdpyaspeilerigrrcgvparmaapadiaaqadivvtatrsttplfagqalragafvg aigsslphtrelddealrraravvvewreqtlseagdlvlaapdtgldakvveladvlagraaarqade diviyksvgvgledvalagyayrrlaaqrgwpap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.21189
    Matthews' coefficent 2.59 Rfactor 0.17820
    Waters 500 Solvent Content 52.42

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;IMD (IMIDAZOLE) x 3
    Metals CL (CHLORIDE) x 7

    Jmol

     
    Google Scholar output for 3hdj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch