.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ha9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.7A Crystal Structure of a Thioredoxin-like Protein from Aeropyrum pernix. To be Published
    Site MCSG
    PDB Id 3ha9 Target Id APC61419.1
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS26894,BAA81585.2, 3.40.30.10, 272557 Molecular Weight 17885.47 Da.
    Residues 162 Isoelectric Point 4.47
    Sequence praaghseevlereasfslttidgevislnnvggdvvilwfmaawcpscvymadlldrltekyreisvi aidfwtaealkalglnkpgypppdtpemfrkfianygdpswimvmddgslvekfnvrsidyivimdkss nvlyagttpslgelesviksvqgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.232
    Matthews' coefficent 2.32 Rfactor 0.194
    Waters 130 Solvent Content 47.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3ha9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch