.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h3m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of flagellar protein FliT from Bordetella bronchiseptica. To be Published
    Site MCSG
    PDB Id 3h3m Target Id APC7626
    Molecular Characteristics
    Source Bordetella bronchiseptica rb50
    Alias Ids TPS28100,NP_889130.1, 257310 Molecular Weight 14060.33 Da.
    Residues 126 Isoelectric Point 6.11
    Sequence mssrpqreksmtaltqhapvleiyqdianltsrmlaaanasnwdlvlnhgqeyvclverlrelepgepl deaargmkfdllvrilendaavrdlalpqlarlsdllgrmkrqqsllatysgkangt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.271
    Matthews' coefficent Rfactor 0.222
    Waters 10 Solvent Content

    Ligand Information
    Ligands UNK x 1
    Metals

    Jmol

     
    Google Scholar output for 3h3m
    1. Structural insight into the regulatory mechanisms of interactions of the flagellar type III chaperone FliT with its binding partners
    K Imada, T Minamino, M Kinoshita - Proceedings of the , 2010 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch