.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the uncharacterized protein ABO_0056 from the hydrocarbon-degrading marine bacterium Alcanivorax borkumensis SK2. TO BE PUBLISHED
    Site MCSG
    PDB Id 3h35 Target Id APC40013
    Molecular Characteristics
    Source Alcanivorax borkumensis sk2
    Alias Ids TPS26883,YP_691776.1, 393595 Molecular Weight 20128.72 Da.
    Residues 181 Isoelectric Point 5.63
    Sequence mlhglkqrlealhhpgelegspqnlhqllgvsieqsvpqaqtmlverhlasltgdearllaalsdgsaf alltlysgsrfsrgevlyrysnagraagiqcndfialylnhlfaqglviasdfteslrtdyelcegdsd frkaqaelqihlpklsirretlrisplgrqlwtlmttpadiee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.15 Rfree 0.212
    Matthews' coefficent 2.11 Rfactor 0.174
    Waters 261 Solvent Content 41.72

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1;SRT (S,R) x 1
    Metals

    Jmol

     
    Google Scholar output for 3h35
    1. Matrix metalloproteinase 9 polymorphism and outcome after myocardial infarction
    S Rodius, G Mulliert, F Azuaje, Y Devaux - , 2011 - pagepressjournals.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch