.
The Open Protein Structure Annotation Network
PDB Keyword
.

3h2z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal strucutre of mannitol-1-phosphate dehydrogenase from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 3h2z Target Id APC28246
    Molecular Characteristics
    Source Shigella flexneri 2a str. 2457t
    Alias Ids TPS26871,AAP19108, 3.40.50.720, 198215 Molecular Weight 41136.82 Da.
    Residues 382 Isoelectric Point 5.44
    Sequence mkalhfgagnigrgfigklladagiqltfadvnqvvldalnarhsyqvhvvgeteqvdtvsgvnavssi gddvvdliaqvdlvttavgpvvleriapaiakglvkrkeqgnesplniiacenmvrgttqlkghvmnal pedakawveehvgfvdsavdrivppsasatndplevtvetfsewivdktqfkgalpnipgmeltdnlma fverklftlntghaitaylgklaghqtirdaildekiravvkgameesgavlikrygfdadkhaayiqk ilgrfenpylkddvervgrqplrklsagdrlikpllgtleyslphknliqgiagamhfrseddpqaqel aaliadkgpqaalaqisgldansevvseavtaykamq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.20400
    Matthews' coefficent 3.16 Rfactor 0.17436
    Waters 255 Solvent Content 61.13

    Ligand Information
    Ligands ACT (ACETATE) x 4;GOL (GLYCEROL) x 1;PO4 (PHOSPHATE) x 4
    Metals NA (SODIUM) x 5

    Jmol

     
    Google Scholar output for 3h2z

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch